Return to main results Retrieve Phyre Job Id

Job DescriptionP19318
Confidence11.99%DateThu Jan 5 11:37:15 GMT 2012
Rank83Aligned Residues53
% Identity17%Templatec2ldiA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:zinc-transporting atpase; PDBTitle: nmr solution structure of ziaan sub mutant
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   243......250.........260.........270.........280.........290.........300.........310.......
Predicted Secondary structure 
































Query SS confidence 










































































Query Sequence  CIFCYPRIESGQPTVCSETCVGRIRYLGVLLYDADRIEEAASTEREVDLYERQCEVFLDPHDPSVIEEALKQGIP
Query Conservation 
  
  
   
  
 
   
    
  
                                  
     
      
Alig confidence 














...........



















...........

















Template Conservation 
  
   
   
   ........... 

  
 
      
 
  
...........        
   
   

Template Sequence  CAACASSIERALERL. . . . . . . . . . . KGVAEASVTVATGRLTVTYD. . . . . . . . . . . PKQVSEITIQERIAALGY
Template Known Secondary structure  TSGGGTGGGG
...........SSTTTT
...........TTT

TTTT
Template Predicted Secondary structure 

...........





...........







Template SS confidence 










































































   1920.........30... ......40.........50... ......60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions