Return to main results Retrieve Phyre Job Id

Job DescriptionP23524
Confidence37.25%DateThu Jan 5 11:39:34 GMT 2012
Rank105Aligned Residues31
% Identity23%Templatec3iz6A_
PDB info PDB header:ribosomeChain: A: PDB Molecule:40s ribosomal protein sa (s2p); PDBTitle: localization of the small subunit ribosomal proteins into a 5.5 a2 cryo-em map of triticum aestivum translating 80s ribosome
Resolution5.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   286...290.........300.........310.........320.....
Predicted Secondary structure 


















Query SS confidence 







































Query Sequence  TLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGIAGS
Query Conservation 







  
 


 

 
  

  
    





 
 
Alig confidence 












.........

















Template Conservation 




 

  
  .........

 

  
 





 

Template Sequence  RLLILTDPRTDHQ. . . . . . . . . PIKESALGNIPTIAFCDT
Template Known Secondary structure  SS
TTTT.........T


T
Template Predicted Secondary structure 





.........




Template SS confidence 







































   124.....130...... ...140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions