Return to main results Retrieve Phyre Job Id

Job DescriptionP23524
Confidence55.19%DateThu Jan 5 11:39:34 GMT 2012
Rank51Aligned Residues33
% Identity21%Templatec3hbmA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:udp-sugar hydrolase; PDBTitle: crystal structure of pseg from campylobacter jejuni
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   277..280.........290.........300.........310.........320..
Predicted Secondary structure 



















Query SS confidence 













































Query Sequence  NLEEHIHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGI
Query Conservation   
   
  








  
 


 

 
  

  
    





Alig confidence 
















.
...........



.










Template Conservation   
  
   

 

  

. ...........
  
.

  
 
 
 
Template Sequence  NIAKLXNESNKLIISAS. S. . . . . . . . . . . LVNE. ALLLKANFKAI
Template Known Secondary structure 
TSS.............TT

Template Predicted Secondary structure 



.............


Template SS confidence 













































   218.220.........230.... . .... 240.........250
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions