Return to main results Retrieve Phyre Job Id

Job DescriptionP23524
Confidence41.21%DateThu Jan 5 11:39:34 GMT 2012
Rank89Aligned Residues28
% Identity32%Templatec2yybA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein ttha1606; PDBTitle: crystal structure of ttha1606 from thermus thermophilus hb8
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   284.....290.........300.........310.........320..
Predicted Secondary structure 


















Query SS confidence 






































Query Sequence  DCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGI
Query Conservation   








  
 


 

 
  

  
    





Alig confidence 













...........













Template Conservation 
 
  



 
   ...........   
   

 

  
Template Sequence  DADLFVTGEPKHSV. . . . . . . . . . . FHETFERGLNVIYA
Template Known Secondary structure 
SSS


GGG...........TT

Template Predicted Secondary structure 






...........


Template SS confidence 






































   181........190.... .....200........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions