Return to main results Retrieve Phyre Job Id

Job DescriptionP23524
Confidence22.32%DateThu Jan 5 11:39:34 GMT 2012
Rank198Aligned Residues33
% Identity24%Templatec2nydB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:upf0135 protein sa1388; PDBTitle: crystal structure of staphylococcus aureus hypothetical protein sa1388
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   279280.........290.........300.........310.........320..
Predicted Secondary structure 


















Query SS confidence 











































Query Sequence  EEHIHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGI
Query Conservation     
  








  
 


 

 
  

  
    





Alig confidence 
















...........















Template Conservation   
   


  





 ...........
    
   

 


 
Template Sequence  QAVQQGADVFVTGDIKH. . . . . . . . . . . HDALDAKIHGVNLIDI
Template Known Secondary structure  TT
SS


...........TT


Template Predicted Secondary structure 







...........


Template SS confidence 











































   292.......300........ .310.........320....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions