Return to main results Retrieve Phyre Job Id

Job DescriptionP23524
Confidence25.08%DateThu Jan 5 11:39:34 GMT 2012
Rank178Aligned Residues48
% Identity19%Templatec1z34A_
PDB info PDB header:transferaseChain: A: PDB Molecule:purine nucleoside phosphorylase; PDBTitle: crystal structure of trichomonas vaginalis purine nucleoside2 phosphorylase complexed with 2-fluoro-2'-deoxyadenosine
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   306...310.........320.........330.........340.........350.........360.........370..
Predicted Secondary structure 



















Query SS confidence 


































































Query Sequence  IGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFRGAYDNICRASRNIAAT
Query Conservation    

  
    





 
        
   

 
   
      
  
       
   
  
 
 
Alig confidence 


















...................




























Template Conservation 


  

    
    
  ...................


                  


    
Template Sequence  AGLFPIADLYGARAGCICT. . . . . . . . . . . . . . . . . . . VSDHILHHEERQNSFQNMMKIALEAAIKL
Template Known Secondary structure  TT
...................SSS



Template Predicted Secondary structure 



...................








Template SS confidence 


































































   183......190.........200. ........210.........220.........230
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions