Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG90
Confidence8.29%DateThu Jan 5 11:28:27 GMT 2012
Rank17Aligned Residues35
% Identity11%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   564.....570.........580.........590.........600.........
Predicted Secondary structure 





Query SS confidence 













































Query Sequence  VIILYAVGTGAIKGFAITTGIGVATSMFTAIVGTRAIVNLLYGGKR
Query Conservation     
                 
   
                    
Alig confidence 














...........



















Template Conservation 




 







 ...........    
          




Template Sequence  FMPLTFIAGIYGYPV. . . . . . . . . . . VLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  TTS


...........TTTTS

Template Predicted Secondary structure  ...........

Template SS confidence 













































   301........310..... ....320.........330.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions