Return to main results Retrieve Phyre Job Id

Job DescriptionP34209
Confidence12.35%DateThu Jan 5 11:53:02 GMT 2012
Rank65Aligned Residues29
% Identity21%Templatec2vt1B_
PDB info PDB header:membrane proteinChain: B: PDB Molecule:surface presentation of antigens protein spas; PDBTitle: crystal structure of the cytoplasmic domain of spa40, the2 specificity switch for the shigella flexneri type iii3 secretion system
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   60.........70.........80.........90.........100.........110...
Predicted Secondary structure 































Query SS confidence 





















































Query Sequence  DQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGRAEATILADIAHQFWHIP
Query Conservation   
 









  
  
   
            
 






  

   


Alig confidence 












........................












.


Template Conservation     

 




 
........................  
  
   
   .


Template Sequence  IAPAPFISLIETN. . . . . . . . . . . . . . . . . . . . . . . . QCALAVRKYANEV. GIP
Template Known Secondary structure  T
SS
........................T.T

Template Predicted Secondary structure 







........................
.


Template SS confidence 





















































   271........280... ......290...... ...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions