Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEW1
Confidence4.85%DateThu Jan 5 11:24:24 GMT 2012
Rank8Aligned Residues24
% Identity38%Templatec3mp7B_
PDB info PDB header:protein transportChain: B: PDB Molecule:preprotein translocase subunit sece; PDBTitle: lateral opening of a translocon upon entry of protein suggests the2 mechanism of insertion into membranes
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   129130.........140.........150........
Predicted Secondary structure 
Query SS confidence 





























Query Sequence  AVALGHFLLGLLCIVSQRNILRQIFGYCLM
Query Conservation    

   
 

 


 




 





  
Alig confidence 
















......






Template Conservation 









 

  

...... 




 
Template Sequence  ITGLGIILIGLIGMLIR. . . . . . IVGILIL
Template Known Secondary structure  ......T
Template Predicted Secondary structure  ......
Template SS confidence 





























   36...40.........50.. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions