Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFU6
Confidence6.36%DateThu Jan 5 11:27:18 GMT 2012
Rank60Aligned Residues31
% Identity23%Templatec2qkmF_
PDB info PDB header:hydrolaseChain: F: PDB Molecule:spac19a8.12 protein; PDBTitle: the crystal structure of fission yeast mrna decapping enzyme dcp1-dcp22 complex
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40
Predicted Secondary structure 








Query SS confidence 






































Query Sequence  GRILLDLSNEVIKQLDDLEVQRNLPRADLLREAVDQYLI
Query Conservation   

 
 
 

    

 

     









  

 
Alig confidence 



















........










Template Conservation   




 
        
  
........ 

 
 
 
 
Template Sequence  ARFILNLPAEEQSSVERLCF. . . . . . . . QIEQAHWFYED
Template Known Secondary structure  TTTS
T
........
Template Predicted Secondary structure 






........
Template SS confidence 






































   17..20.........30...... ...40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions