Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACE3
Confidence7.47%DateThu Jan 5 11:18:00 GMT 2012
Rank40Aligned Residues21
% Identity33%Templatec2gutA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:arc/mediator, positive cofactor 2 glutamine/q- PDBTitle: solution structure of the trans-activation domain of the2 human co-activator arc105
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30...
Predicted Secondary structure 







Query SS confidence 





























Query Sequence  KPLTKTDYLMRLRRCQTIDTLERVIEKNKY
Query Conservation 
 


 
 
 
 




 







    
Alig confidence 








.........











Template Conservation 

 





.........  




 
 
 
Template Sequence  KAKTRDEYL. . . . . . . . . SLVARLIIHFRD
Template Known Secondary structure 
SS.........
Template Predicted Secondary structure 



.........
Template SS confidence 





























   48.50...... ...60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions