Return to main results Retrieve Phyre Job Id

Job DescriptionP67624
Confidence3.50%DateThu Jan 5 12:10:44 GMT 2012
Rank73Aligned Residues38
% Identity26%Templatec1f7uA_
PDB info PDB header:ligase/rnaChain: A: PDB Molecule:arginyl-trna synthetase; PDBTitle: crystal structure of the arginyl-trna synthetase complexed with the2 trna(arg) and l-arg
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.......
Predicted Secondary structure 

















Query SS confidence 

















































Query Sequence  LSPETLENLIESFVLREGTDYGEHERTLEQKVADVKRQLQCGEAVLVWSE
Query Conservation 
  


  













  
 

  

 

  

  
 
 



 
Alig confidence 


























............










Template Conservation 
    
   

  
      

     ............   

 




Template Sequence  FNPQFLAKLVIPDILTRKEDYGSCKLV. . . . . . . . . . . . ENKKVIIEFSS
Template Known Secondary structure 
GGGTT



S............S




Template Predicted Secondary structure 











............




Template SS confidence 

















































   114.....120.........130.........140 .........150.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions