Return to main results Retrieve Phyre Job Id

Job DescriptionP39160
Confidence6.61%DateThu Jan 5 11:58:16 GMT 2012
Rank79Aligned Residues37
% Identity24%Templatec2rkhA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:putative apha-like transcription factor; PDBTitle: crystal structure of a putative apha-like transcription factor2 (zp_00208345.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a3 resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   124.....130.........140.........150.........160.........170...
Predicted Secondary structure 
























Query SS confidence 

















































Query Sequence  SLTVTEKGYCADAASGQLDLNNPLIKHDLENPTAPKSAIGYIVEALRLRR
Query Conservation 
 



 

        

   
 
  

     
 
  
 
   
  
 
Alig confidence 










.............

























Template Conservation   
 

  


 .............
  


  


 
 
 

 
 


 
Template Sequence  XLAISAAGRRE. . . . . . . . . . . . . LHSLLTARLRPGSDLSKLVVALKXRF
Template Known Secondary structure 
.............S



SSS
TT
Template Predicted Secondary structure 
.............







Template SS confidence 

















































   77..80....... ..90.........100.........110...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions