Return to main results Retrieve Phyre Job Id

Job DescriptionP32700
Confidence9.28%DateThu Jan 5 11:50:20 GMT 2012
Rank4Aligned Residues22
% Identity23%Templatec3mkoA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:glycoprotein c; PDBTitle: crystal structure of the lymphocytic choriomeningitis virus membrane2 fusion glycoprotein gp2 in its postfusion conformation
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80........
Predicted Secondary structure 







Query SS confidence 






























Query Sequence  LLGITMADITAIWHNIESVMIEEMNQTPPQW
Query Conservation 





   
 

       







 

Alig confidence 












.........








Template Conservation 

 









.........





 

Template Sequence  LMGVPYCNYSKFW. . . . . . . . . YLEHAPKCW
Template Known Secondary structure  GTT

B



.........


SB
Template Predicted Secondary structure 






.........



Template SS confidence 






























   364.....370...... ...380.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions