Return to main results Retrieve Phyre Job Id

Job DescriptionP32700
Confidence12.53%DateThu Jan 5 11:50:20 GMT 2012
Rank2Aligned Residues44
% Identity30%Templatec2cj9A_
PDB info PDB header:ligaseChain: A: PDB Molecule:seryl-trna synthetase; PDBTitle: crystal structure of methanosarcina barkeri seryl-trna2 synthetase complexed with an analog of seryladenylate
Resolution2.3 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60.........70.........80.........
Predicted Secondary structure 













Query SS confidence 



































































Query Sequence  FLASTLNIRFRRSDYVGLAVISSGLGVVSACWFAMGLLGITMADITAIWHNIESVMIEEMNQTPPQWP
Query Conservation 
 








  
  


 
 




   











   
 

       







 


Alig confidence 

















..





..





....................













Template Conservation   

  
 
      

  .. 
 
 
..


 
 ....................



  
 
   

Template Sequence  KYPKGFNVKLQSGDELWS. . GCSGVG. . LERWAA. . . . . . . . . . . . . . . . . . . . VFLAQKGLDPANWP
Template Known Secondary structure  T
TT



........................
S
TTTS
Template Predicted Secondary structure 









..


......................







Template SS confidence 



































































   442.......450......... 460..... ....470. ........480.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions