Return to main results Retrieve Phyre Job Id

Job DescriptionP0AG76
Confidence23.53%DateThu Jan 5 11:28:20 GMT 2012
Rank234Aligned Residues39
% Identity18%Templatec2pfsA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:universal stress protein; PDBTitle: crystal structure of universal stress protein from nitrosomonas2 europaea
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40..... ....50.........60.........70.........80.
Predicted Secondary structure 



.














Query SS confidence 


















.



































Query Sequence  FLDWLLETAQTHQVDAIIV. AGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLA
Query Conservation      
   
    

 


.





               
  
    


  
 
Alig confidence 


















.

................

















Template Conservation      
   
     



 

 ................
 
  
      





Template Sequence  PREEIIRIAEQENVDLIVVGSH. . . . . . . . . . . . . . . . STANSVLHYAKCDVLAVR
Template Known Secondary structure  TT
S
................

SS
Template Predicted Secondary structure 






................



Template SS confidence 























































   95....100.........110...... ...120.........130....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions