Return to main results Retrieve Phyre Job Id

Job DescriptionP43340
Confidence92.60%DateThu Jan 5 12:02:20 GMT 2012
Rank70Aligned Residues60
% Identity10%Templatec3u80A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:3-dehydroquinate dehydratase, type ii; PDBTitle: 1.60 angstrom resolution crystal structure of a 3-dehydroquinate2 dehydratase-like protein from bifidobacterium longum
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.........70.........80...
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  ERIYLVWAHPRHDSLTAHIADAIHQRAMERKIQVTELDLYRRNFNPVMTPEDEPDWKNMDKRYSPEVHQLYSELLEHDTL
Query Conservation   




 



  
 
  
       
   
 

    
                                  
  

 
Alig confidence 







.

































.....................















Template Conservation    





.



 

  
       
  

      


 

.....................



 
  
    


Template Sequence  TKVIVVNG. PNLRQDLDTLRKLCAEWGKDLGLEVEVRQTDDEA. . . . . . . . . . . . . . . . . . . . . EMVRWMHQAADEKTPV
Template Known Secondary structure 
.S


TT
S
.....................T

Template Predicted Secondary structure 

.











.....................



Template SS confidence 















































































   2....... 10.........20.........30.........40... ......50.........
 
   84.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  VV
Query Conservation 

Alig confidence 

Template Conservation 

Template Sequence  VM
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   72.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions