Return to main results Retrieve Phyre Job Id

Job DescriptionP43340
Confidence22.36%DateThu Jan 5 12:02:20 GMT 2012
Rank281Aligned Residues59
% Identity15%Templatec3ce9A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:glycerol dehydrogenase; PDBTitle: crystal structure of glycerol dehydrogenase (np_348253.1) from2 clostridium acetobutylicum at 2.37 a resolution
Resolution2.37 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.........70.........80...
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  ERIYLVWAHPRHDSLTAHIADAIHQRAMERKIQVTELDLYRRNFNPVMTPEDEPDWKNMDKRYSPEVHQLYSELLEHDTL
Query Conservation   




 



  
 
  
       
   
 

    
                                  
  

 
Alig confidence 








....
























..................























Template Conservation   
 




 ....         
   
   

      ..................                     
 
Template Sequence  KRVSLYFGE. . . . GIYELFGETIEKSIKSSNIEIEAVE. . . . . . . . . . . . . . . . . . TVKNIDFDEIGTNAFKIPAEVDAL
Template Known Secondary structure  ST....TTTT
..................


BTTS
TT

Template Predicted Secondary structure 


....


..................










Template SS confidence 















































































   34.....40.. .......50.........60....... ..70.........80.........90.
 
   84
Predicted Secondary structure 
Query SS confidence 
Query Sequence  V
Query Conservation 
Alig confidence 
Template Conservation 
Template Sequence  I
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 
   92
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions