Return to main results Retrieve Phyre Job Id

Job DescriptionP0A738
Confidence2.58%DateThu Jan 5 11:04:42 GMT 2012
Rank91Aligned Residues41
% Identity27%Templatec2i9zB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:putative septation protein spovg; PDBTitle: structural genomics, the crystal structure of full-length spovg from2 staphylococcus epidermidis atcc 12228
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   85....90.........100.........110.........120.........130.........140.........150......
Predicted Secondary structure 


















Query SS confidence 







































































Query Sequence  EVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFK
Query Conservation   
          
 
   
   
 













 





 




   
  
 
  
 




   
Alig confidence 


















............................














...






Template Conservation 



        


 


............................
 

 


  




...
  



Template Sequence  DVRLRKIQTDGRXKALVSI. . . . . . . . . . . . . . . . . . . . . . . . . . . . TLDEAFVIHDLRVIE. . . GNSGLFV
Template Known Secondary structure 


SSS............................TTT
...
TT

Template Predicted Secondary structure 




............................



...




Template SS confidence 







































































   5....10.........20... ......30........ .40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions