Return to main results Retrieve Phyre Job Id

Job DescriptionP76180
Confidence6.58%DateThu Jan 5 12:20:11 GMT 2012
Rank9Aligned Residues26
% Identity27%Templated1wixa_
SCOP infoCH domain-like Hook domain Hook domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   112.......120.........130.........140....
Predicted Secondary structure 



Query SS confidence 
































Query Sequence  DGIAVRQLLFTLLATALIVPYFKRSSRVKATFV
Query Conservation 
   
  
  


 
 





  
 


 


Alig confidence 
















......



.




Template Conservation     

 


 



 

...... 
  .

  
Template Sequence  DPVELGRLLQLILGCAV. . . . . . NCEK. KQEHI
Template Known Secondary structure 
TT......SSST.
Template Predicted Secondary structure 
......



.
Template SS confidence 
































   109110.........120..... .... 130....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions