Return to main results Retrieve Phyre Job Id

Job DescriptionP16095
Confidence20.74%DateThu Jan 5 11:35:01 GMT 2012
Rank15Aligned Residues27
% Identity26%Templatec2kelB_
PDB info PDB header:transcription repressorChain: B: PDB Molecule:uncharacterized protein 56b; PDBTitle: structure of the transcription regulator svtr from the2 hyperthermophilic archaeal virus sirv1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   177..180.........190.........200.........210..
Predicted Secondary structure 







Query SS confidence 



































Query Sequence  LLAYCNETGYSLSGLAMQNELALHSKKEIDEYFAHV
Query Conservation 

  
      
   
   
        
   
   
Alig confidence 















.........










Template Conservation 





 
       
......... 

  



 
Template Sequence  LKVYCAKNNLQLTQAI. . . . . . . . . EEAIKEYLQKR
Template Known Secondary structure  S


.........
Template Predicted Secondary structure 


.........
Template SS confidence 



































   28.30.........40... ......50....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions