Return to main results Retrieve Phyre Job Id

Job DescriptionP16095
Confidence13.93%DateThu Jan 5 11:35:01 GMT 2012
Rank22Aligned Residues28
% Identity25%Templatec2k9iB_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:plasmid prn1, complete sequence; PDBTitle: nmr structure of plasmid copy control protein orf56 from2 sulfolobus islandicus
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   175....180.........190.........200.........210.
Predicted Secondary structure 







Query SS confidence 




































Query Sequence  TELLAYCNETGYSLSGLAMQNELALHSKKEIDEYFAH
Query Conservation   


  
      
   
   
        
   
  
Alig confidence 

















.........









Template Conservation 
 
 





 





 .........








 
Template Sequence  DRLMEIAKEKNLTLSDVC. . . . . . . . . RLAIKEYLDN
Template Known Secondary structure  T

.........
Template Predicted Secondary structure 



.........
Template SS confidence 




































   23......30.........40 .........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions