Return to main results Retrieve Phyre Job Id

Job DescriptionP0A821
Confidence23.02%DateThu Jan 5 11:06:39 GMT 2012
Rank485Aligned Residues24
% Identity13%Templatec2wanA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:pullulanase; PDBTitle: pullulanase from bacillus acidopullulyticus
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   235....240 .........250........
Predicted Secondary structure 





.......


Query SS confidence 





. . . . . . .

















Query Sequence  FTKAID. . . . . . . EAELVALGKELDVPVVTD
Query Conservation        .......
  
  

   

 

 
Alig confidence 





.......

















Template Conservation 


  
    
 


 

 


 


 



Template Sequence  YATTPEGTARITELKQLIQSLHQQRIGVNMD
Template Known Secondary structure  GSS
SSTTTT
Template Predicted Secondary structure 











Template SS confidence 






























   521........530.........540.........550.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions