Return to main results Retrieve Phyre Job Id

Job DescriptionQ46835
Confidence1.92%DateThu Jan 5 12:35:01 GMT 2012
Rank54Aligned Residues37
% Identity8%Templatec2rrlA_
PDB info PDB header:protein transportChain: A: PDB Molecule:flagellar hook-length control protein; PDBTitle: solution structure of the c-terminal domain of the flik
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   48.50.........60.........70.........80.........90.........100.......
Predicted Secondary structure 




















Query SS confidence 



























































Query Sequence  PIKSAGYTLVLAQSSGTTVKMTIISEAGTQTTQTPDAFLTSYQRQMCADPTVKLMITEGI
Query Conservation 


   
 

 
 
 
  


  

  

     


  
     

   





  

Alig confidence 













.








......................













Template Conservation 
  

 
 
 
   .     
   ......................
        
    
Template Sequence  PEELGQVHISLKLD. DNQAQLQMV. . . . . . . . . . . . . . . . . . . . . . SPHSHVRAALEAAL
Template Known Secondary structure  SGGG

.TT......................

SST
Template Predicted Secondary structure 




.

......................

Template SS confidence 



























































   95....100........ .110....... ..120.........130.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions