Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6C8
Confidence24.94%DateThu Jan 5 11:02:50 GMT 2012
Rank67Aligned Residues53
% Identity26%Templatec2i55C_
PDB info PDB header:isomeraseChain: C: PDB Molecule:phosphomannomutase; PDBTitle: complex of glucose-1,6-bisphosphate with phosphomannomutase from2 leishmania mexicana
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   175....180.........190.........200.........210.........220.........230.........240........
Predicted Secondary structure 
































Query SS confidence 









































































Query Sequence  DLILLSDVSGILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHAEQLPALFN
Query Conservation   


 





   

  
  
   
           


  
   
      
   
 
     
  
     
Alig confidence 



















.....................
































Template Conservation 



  






     
 .....................     

  
   

 
 




          
Template Sequence  KAILLFDVDGTLTPPRNPET. . . . . . . . . . . . . . . . . . . . . HDMKEALLKARAAGFKLGVVGGSDFAKQKEQLG
Template Known Secondary structure 

STTTTSSTTS


.....................TT
SS

Template Predicted Secondary structure 













.....................






Template SS confidence 









































































   4.....10.........20... ......30.........40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions