Return to main results Retrieve Phyre Job Id

Job DescriptionP76208
Confidence4.77%DateThu Jan 5 12:20:33 GMT 2012
Rank45Aligned Residues21
% Identity43%Templated1nvpd1
SCOP infoTranscription factor IIA (TFIIA), alpha-helical domain Transcription factor IIA (TFIIA), alpha-helical domain Transcription factor IIA (TFIIA), alpha-helical domain
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   97..100.........110.........120.......
Predicted Secondary structure 
Query SS confidence 






























Query Sequence  VGLALQDSGARMSRQARFLREGVEDQLILEK
Query Conservation 




 


  



   

  





 
 
Alig confidence 







..........












Template Conservation 

 

 

..........




    
 
 
Template Sequence  LGNSLQES. . . . . . . . . . LDELIQSQQITPQ
Template Known Secondary structure  ..........TTSS
Template Predicted Secondary structure  ..........




Template SS confidence 






























   11....... .20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions