Return to main results Retrieve Phyre Job Id

Job DescriptionP75961
Confidence3.52%DateThu Jan 5 12:16:30 GMT 2012
Rank45Aligned Residues33
% Identity27%Templatec3qftA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:nadph--cytochrome p450 reductase; PDBTitle: crystal structure of nadph-cytochrome p450 reductase (fad/nadph domain2 and r457h mutant)
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80... ......90.........100....
Predicted Secondary structure 











..










Query SS confidence 




























. .




















Query Sequence  TGIAPFIVVLPDINNEASLRQNGKAMLAH. . ASSSLSDVKGSVLLLFTTREP
Query Conservation 




























..




















Alig confidence 





.................





..




















Template Conservation 





.................




 
          
   



 
  
Template Sequence  TGVAPF. . . . . . . . . . . . . . . . . IGFIQERAWLRQQGKEVGETLLYYGCRRS
Template Known Secondary structure  GGG.................T




S
T
Template Predicted Secondary structure 

.................









Template SS confidence 



















































   538.540... ......550.........560.........570..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions