Return to main results Retrieve Phyre Job Id

Job DescriptionP75961
Confidence3.58%DateThu Jan 5 12:16:30 GMT 2012
Rank43Aligned Residues37
% Identity35%Templatec2qtzA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine synthase reductase; PDBTitle: crystal structure of the nadp+-bound fad-containing fnr-like module of2 human methionine synthase reductase
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100....
Predicted Secondary structure 






















Query SS confidence 

















































Query Sequence  TGIAPFIVVLPDINNEASLRQNGKAMLAHASSSLSDVKGSVLLLFTTREP
Query Conservation 

















































Alig confidence 
























.............











Template Conservation 










 
            .............
   



 
  
Template Sequence  TGIAPFIGFLQHREKLQEQHPDGNF. . . . . . . . . . . . . GAMWLFFGCRHK
Template Known Secondary structure  GGGSTT


.............

S
T
Template Predicted Secondary structure 








.............



Template SS confidence 

















































   547..550.........560.........570. ........580...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions