Return to main results Retrieve Phyre Job Id

Job DescriptionP75961
Confidence2.97%DateThu Jan 5 12:16:30 GMT 2012
Rank64Aligned Residues38
% Identity21%Templatec2ok8D_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:putative ferredoxin--nadp reductase; PDBTitle: ferredoxin-nadp+ reductase from plasmodium falciparum
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100....
Predicted Secondary structure 






















Query SS confidence 

















































Query Sequence  TGIAPFIVVLPDINNEASLRQNGKAMLAHASSSLSDVKGSVLLLFTTREP
Query Conservation 

















































Alig confidence 
























............












Template Conservation   



  
 
  
            ............   
 
    
  
Template Sequence  TGISPYISFLKKLFAYDLYNRNSNY. . . . . . . . . . . . TGYITIYYGVYNE
Template Known Secondary structure  GGGTT









............


SSG
Template Predicted Secondary structure 











............





Template SS confidence 

















































   180.........190.........200.... .....210.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions