Return to main results Retrieve Phyre Job Id

Job DescriptionP75961
Confidence3.07%DateThu Jan 5 12:16:30 GMT 2012
Rank59Aligned Residues33
% Identity30%Templatec1j9zB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nadph-cytochrome p450 reductase; PDBTitle: cypor-w677g
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80... ......90.........100....
Predicted Secondary structure 











..










Query SS confidence 




























. .




















Query Sequence  TGIAPFIVVLPDINNEASLRQNGKAMLAH. . ASSSLSDVKGSVLLLFTTREP
Query Conservation 




























..




















Alig confidence 





.................





..




















Template Conservation 





.................




 
          
   
  
 
  
Template Sequence  TGIAPF. . . . . . . . . . . . . . . . . MGFIQERAWLREQGKEVGETLLYYGCRRS
Template Known Secondary structure  GGG.................TT




S
T
Template Predicted Secondary structure 

.................








Template SS confidence 



















































   535....540 .........550.........560.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions