Return to main results Retrieve Phyre Job Id

Job DescriptionP75961
Confidence5.34%DateThu Jan 5 12:16:30 GMT 2012
Rank19Aligned Residues36
% Identity33%Templatec1f20A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:nitric-oxide synthase; PDBTitle: crystal structure of rat neuronal nitric-oxide synthase fad/nadp+2 domain at 1.9a resolution.
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100....
Predicted Secondary structure 






















Query SS confidence 

















































Query Sequence  TGIAPFIVVLPDINNEASLRQNGKAMLAHASSSLSDVKGSVLLLFTTREP
Query Conservation 

















































Alig confidence 






..........
















....











Template Conservation 






..........
 

 
           ....
   

 
 
  
Template Sequence  TGIAPFR. . . . . . . . . . SFWQQRQFDIQHKGMNP. . . . CPMVLVFGCRQS
Template Known Secondary structure  GGG..........



....

S
T
Template Predicted Secondary structure 

..........




....



Template SS confidence 

















































   1251...... ..1260.........1270.... .....1280......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions