Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8Q0
Confidence2.91%DateWed Jan 25 15:20:18 GMT 2012
Rank57Aligned Residues35
% Identity29%Templated1z9ha1
SCOP infoGST C-terminal domain-like GST C-terminal domain-like Glutathione S-transferase (GST), C-terminal domain
Resolution2.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   44.....50.........60.........70.........80.........90......
Predicted Secondary structure 




Query SS confidence 




















































Query Sequence  IFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAAN
Query Conservation 
 

  
  
  
   

  
 

  
 





 
 



 


 
 



 
Alig confidence 




...















...............













Template Conservation 




... 



  

 
   

............... 
  

 


 

 
Template Sequence  VYGVL. . . RVMEGLDAFDDLMQHT. . . . . . . . . . . . . . . HIQPWYLRVERAIT
Template Known Secondary structure  ...TTTTS...............S
Template Predicted Secondary structure  ...



...............

Template SS confidence 




















































   337..340. ........350....... ..360.........370.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions