Return to main results Retrieve Phyre Job Id

Job DescriptionP09154
Confidence41.92%DateThu Jan 5 11:02:02 GMT 2012
Rank2Aligned Residues25
% Identity28%Templatec3o0rC_
PDB info PDB header:immune system/oxidoreductaseChain: C: PDB Molecule:nitric oxide reductase subunit c; PDBTitle: crystal structure of nitric oxide reductase from pseudomonas2 aeruginosa in complex with antibody fragment
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   97..100.........110.........120.........
Predicted Secondary structure 













Query SS confidence 
































Query Sequence  LKEDELKQYNLWLDYLEALELVDTSSAPDIEWP
Query Conservation 

  
   
  
  

  
 


 
 



 

Alig confidence 













...







.....


Template Conservation 





  
 



...    

  .....  
Template Sequence  LSEGQVDDLAEFLK. . . WSSKIDTN. . . . . QWP
Template Known Secondary structure 

...TTS

S.....S
S
Template Predicted Secondary structure 

...






.....


Template SS confidence 
































   117..120.........130 ........ .140.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions