Return to main results Retrieve Phyre Job Id

Job DescriptionP09154
Confidence4.30%DateThu Jan 5 11:02:02 GMT 2012
Rank23Aligned Residues23
% Identity30%Templatec2jr1A_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:virulence regulator; PDBTitle: solution structure of the dna binding domain of a nucleoid-associated2 protein, h-ns, from the phytopathogen xylella fastidiosa.
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   100.........110.........120.........130...
Predicted Secondary structure 















Query SS confidence 

































Query Sequence  DELKQYNLWLDYLEALELVDTSSAPDIEWPTPPA
Query Conservation   
   
  
  

  
 


 
 



 

  
 
Alig confidence 










...........











Template Conservation   
    
 

 ........... 


  

   
Template Sequence  IGTAAYTAWKA. . . . . . . . . . . KHPDEKFPAFPG
Template Known Secondary structure  TT...........SSS
S





Template Predicted Secondary structure 


...........










Template SS confidence 

































   57..60....... ..70.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions