Return to main results Retrieve Phyre Job Id

Job DescriptionP52137
Confidence1.40%DateThu Jan 5 12:05:41 GMT 2012
Rank28Aligned Residues41
% Identity10%Templatec3lw5K_
PDB info PDB header:photosynthesisChain: K: PDB Molecule:photosystem i reaction center subunit x psak; PDBTitle: improved model of plant photosystem i
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   65....70.........80.........90.........100.........110.........120....
Predicted Secondary structure 















Query SS confidence 



























































Query Sequence  VSNLVNIVSADFFGLSFAQYASVMISVDAAAIAATLIMLYLFFRRVIPATYXVSLLKTPA
Query Conservation   
   
 
                             
                      
Alig confidence 








...................































Template Conservation 


 
 


...................
 


  
 





 
 

 
          
Template Sequence  IGSPTNLIM. . . . . . . . . . . . . . . . . . . VTSTSLMLFAGRFGLAPSANRKATAGLKLEVR
Template Known Secondary structure  GGT...................TT



S

SSSSS


Template Predicted Secondary structure 




...................




Template SS confidence 



























































   4950....... ..60.........70.........80.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions