Return to main results Retrieve Phyre Job Id

Job DescriptionP00914
Confidence6.48%DateThu Jan 5 10:57:10 GMT 2012
Rank70Aligned Residues27
% Identity30%Templatec1p4eB_
PDB info PDB header:dna binding protein/recombination/dnaChain: B: PDB Molecule:recombinase flp protein; PDBTitle: flpe w330f mutant-dna holliday junction complex
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   341........350.........360.........370.........380...
Predicted Secondary structure 













Query SS confidence 










































Query Sequence  HNRLRMITASFLVKDLLIDWREGERYFMSQLIDGDLAANNGGW
Query Conservation 


 

 




   
 
 
  

  
   


 
 
 
   
Alig confidence 
















................









Template Conservation 







 



  

................   

  


Template Sequence  SHIGRHLMTSFLSMKGL. . . . . . . . . . . . . . . . TELTNVVGNF
Template Known Secondary structure  TTTT
................T
Template Predicted Secondary structure 


................







Template SS confidence 










































   304.....310.........320 .........330
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions