Return to main results Retrieve Phyre Job Id

Job DescriptionP77694
Confidence14.52%DateThu Jan 5 12:31:44 GMT 2012
Rank16Aligned Residues32
% Identity47%Templatec3biyA_
PDB info PDB header:transferaseChain: A: PDB Molecule:histone acetyltransferase p300; PDBTitle: crystal structure of p300 histone acetyltransferase domain in complex2 with a bisubstrate inhibitor, lys-coa
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   401........410.........420.........430.........440.....
Predicted Secondary structure 
















Query SS confidence 












































Query Sequence  VGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFS
Query Conservation 

 
  



 
 

 


 






 
 

 
 
 
  

 

Alig confidence 













.............

















Template Conservation      
 
  




.............
 
 










 
 
Template Sequence  VDSGEMAESFPYRT. . . . . . . . . . . . . KALFAFEEIDGVDLCFFG
Template Known Secondary structure  TTTTSS
S.............TT
Template Predicted Secondary structure 













.............

Template SS confidence 












































   1344.....1350....... ..1360.........1370.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions