Return to main results Retrieve Phyre Job Id

Job DescriptionP76322
Confidence2.04%DateThu Jan 5 12:21:48 GMT 2012
Rank69Aligned Residues27
% Identity37%Templatec3bunB_
PDB info PDB header:ligase/signaling proteinChain: B: PDB Molecule:e3 ubiquitin-protein ligase cbl; PDBTitle: crystal structure of c-cbl-tkb domain complexed with its2 binding motif in sprouty4
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100........ .110..
Predicted Secondary structure 




.

Query SS confidence 





























.



Query Sequence  FEWGDYSLWFQDFSIYNKIGFIMIEKIREL. VTHP
Query Conservation 





























.



Alig confidence 













.......








.



Template Conservation 












 .......
 
 

  


 

Template Sequence  FEFDIFTRLFQPWS. . . . . . . SLLRNWNSLAVTHP
Template Known Secondary structure  T

GG.......GTTS
T
Template Predicted Secondary structure  .......


Template SS confidence 


































   239240.........250.. .......260......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions