Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFY8
Confidence4.74%DateThu Jan 5 11:27:35 GMT 2012
Rank91Aligned Residues29
% Identity28%Templatec3hxxA_
PDB info PDB header:ligaseChain: A: PDB Molecule:alanyl-trna synthetase; PDBTitle: crystal structure of catalytic fragment of e. coli alars in complex2 with amppcp
Resolution2.11 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20. ........30...
Predicted Secondary structure 


...........


Query SS confidence 
















. . . . . . . . . . .











Query Sequence  EVDDELYSYIASHTKHI. . . . . . . . . . . GESASDILRRML
Query Conservation 






 



 
  
...........











Alig confidence 
















...........











Template Conservation     
 
 





 
   
 
 


 


 









Template Sequence  DLSNKSLRVIADHIRSCAFLIADGVMPSNENRGYVLRRII
Template Known Secondary structure  SS

TT



SS
Template Predicted Secondary structure 
















Template SS confidence 







































   274.....280.........290.........300.........310...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions