Return to main results Retrieve Phyre Job Id

Job DescriptionP62066
Confidence1.84%DateThu Jan 5 12:07:28 GMT 2012
Rank79Aligned Residues27
% Identity48%Templatec3rrrB_
PDB info PDB header:viral proteinChain: B: PDB Molecule:fusion glycoprotein f0; PDBTitle: structure of the rsv f protein in the post-fusion conformation
Resolution2.82 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20 .........
Predicted Secondary structure 












............








Query SS confidence 

















. . . . . . . . . . . .








Query Sequence  VARFSCGKTAQLSKKQTG. . . . . . . . . . . . YYSPEIFPS
Query Conservation 

















............








Alig confidence 

















............








Template Conservation 






































Template Sequence  VDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPS
Template Known Secondary structure 
STTSS























Template Predicted Secondary structure 



















Template SS confidence 






































   447..450.........460.........470.........480.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions