Return to main results Retrieve Phyre Job Id

Job DescriptionP62066
Confidence12.97%DateThu Jan 5 12:07:28 GMT 2012
Rank4Aligned Residues32
% Identity41%Templatec2pmzN_
PDB info PDB header:translation, transferaseChain: N: PDB Molecule:dna-directed rna polymerase subunit n; PDBTitle: archaeal rna polymerase from sulfolobus solfataricus
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10 .........20.........30.........40.........50..
Predicted Secondary structure 



......

























Query SS confidence 




. . . . . .









































Query Sequence  FSCGK. . . . . . TAQLSKKQTGYYSPEIFPSTGKDCNPQPANCLKDQYVLRHCC
Query Conservation 




......









































Alig confidence 




......










...............















Template Conservation 






    
 
   
    ...............   
 

 


 



Template Sequence  FTCGSLIADKWQSFITRVNAGE. . . . . . . . . . . . . . . NPGKVLDDLGVKRYCC
Template Known Secondary structure  TTT



TTTSS...............
SSS

SS
Template Predicted Secondary structure 







...............




Template SS confidence 




















































   8.10.........20......... 30.........40.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions