Return to main results Retrieve Phyre Job Id

Job DescriptionP06864
Confidence25.54%DateThu Jan 5 10:59:27 GMT 2012
Rank275Aligned Residues42
% Identity17%Templatec2jgdA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2-oxoglutarate dehydrogenase e1 component; PDBTitle: e. coli 2-oxoglutarate dehydrogenase (e1o)
Resolution2.6 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   381........390.........400.........410.........420.........430.........440...
Predicted Secondary structure 


























Query SS confidence 






























































Query Sequence  PRFYELCDIYGLFVMAETDVESHGFANVGDISRITDDPQWEKVYVERIVRHIHAQKNHPSIII
Query Conservation    






 

 
 


  
 

             
            

 








 
Alig confidence 














.....................


























Template Conservation 





    
  
 ..................... 




  






     





 
Template Sequence  ERYLQLCAEQNMQVC. . . . . . . . . . . . . . . . . . . . . VPSTPAQVYHMLRRQALRGMRRPLVVM
Template Known Secondary structure  T

TT

.....................


SSS



Template Predicted Secondary structure 



.....................








Template SS confidence 






























































   735....740......... 750.........760.........770......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions