Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACB2
Confidence21.85%DateThu Jan 5 11:17:47 GMT 2012
Rank279Aligned Residues40
% Identity18%Templatec1znnF_
PDB info PDB header:biosynthetic proteinChain: F: PDB Molecule:plp synthase; PDBTitle: structure of the synthase subunit of plp synthase
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   253......260.........270.........280.........290.........300.........310.
Predicted Secondary structure 
















Query SS confidence 


























































Query Sequence  LDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGSIKRAGADLIFS
Query Conservation 




  
     

 














  
  
   
  


 
 





 


Alig confidence 















..............






.....
















Template Conservation     
  
   
 



..............    
 
.....  

      


 
  
Template Sequence  PTVIEEVMNAVSIPVM. . . . . . . . . . . . . . AKVRIGH. . . . . YVEARVLEALGVDYIDE
Template Known Secondary structure 
SS
..............TT
.....TT
S
Template Predicted Secondary structure 



..............





.....



Template SS confidence 


























































   64.....70......... 80...... ...90.........100...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions