Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8X0
Confidence4.37%DateThu Jan 5 11:08:53 GMT 2012
Rank56Aligned Residues25
% Identity24%Templatec2k5jB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized protein yiif; PDBTitle: solution structure of protein yiif from shigella flexneri2 serotype 5b (strain 8401) . northeast structural genomics3 consortium target sft1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   46...50....... ..60.........70
Predicted Secondary structure 


.........


Query SS confidence 











. . . . . . . . .












Query Sequence  IVDLGKNALDKI. . . . . . . . . PLDADLRAAIELA
Query Conservation 
  

  

  
.........

 
 
  

  
Alig confidence 











.........












Template Conservation   
 
 

 
  

 

     










 
Template Sequence  LLDLSNEVIKQLDDLEVQRNLPRADLLREAVDQY
Template Known Secondary structure 




TTS
Template Predicted Secondary structure 







Template SS confidence 

































   213......220.........230.........240......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions