Return to main results Retrieve Phyre Job Id

Job DescriptionP02929
Confidence60.83%DateThu Jan 5 10:57:41 GMT 2012
Rank12Aligned Residues47
% Identity21%Templatec3onrI_
PDB info PDB header:metal binding proteinChain: I: PDB Molecule:protein transport protein sece2; PDBTitle: crystal structure of the calcium chelating immunodominant antigen,2 calcium dodecin (rv0379),from mycobacterium tuberculosis with a novel3 calcium-binding site
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   191........200.........210.........220.. .......230........
Predicted Secondary structure 













..................


Query SS confidence 































. . . . . . . . . . . . . . . . . .















Query Sequence  VQILSAKPANMFEREVKNAMRRWRYEPGKPGS. . . . . . . . . . . . . . . . . . GIVVNILFKINGTTEI
Query Conservation    
  


   

 

  

 
    
     ..................   
 
 
 
 
    
Alig confidence 









.




















..................















Template Conservation 




 
  
. 



  

  
 


 

   

 
    
  
 
  


 


 
 
  
   
Template Sequence  IDIIGTSPTS. WEQAAAEAVQRARDSVDDIRVARVIEQDMAVDSAGKITYRIKLEVSFKMRPSQPL
Template Known Secondary structure  SS
.TT
S




TT



SSS

Template Predicted Secondary structure 



.











Template SS confidence 

































































   7..10...... ...20.........30.........40.........50.........60.........70.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions