Return to main results Retrieve Phyre Job Id

Job DescriptionP02929
Confidence8.15%DateThu Jan 5 10:57:41 GMT 2012
Rank75Aligned Residues27
% Identity22%Templatec2kl8A_
PDB info PDB header:de novo proteinChain: A: PDB Molecule:or15; PDBTitle: solution nmr structure of de novo designed ferredoxin-like2 fold protein, northeast structural genomics consortium3 target or15
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   201........210.........220.........230.....
Predicted Secondary structure 










Query SS confidence 


































Query Sequence  MFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGT
Query Conservation   

 

  

 
    
        
 
 
 
 
 
Alig confidence 













........












Template Conservation 













........












Template Sequence  AFEKALKEMIRQAR. . . . . . . . KFAGTVTYTLDGN
Template Known Secondary structure  T........TTT

SS
Template Predicted Secondary structure  ........



Template SS confidence 


































   14.....20....... ..30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions