Return to main results Retrieve Phyre Job Id

Job DescriptionP50466
Confidence56.53%DateThu Jan 5 12:04:47 GMT 2012
Rank91Aligned Residues33
% Identity24%Templatec3ka5A_
PDB info PDB header:chaperoneChain: A: PDB Molecule:ribosome-associated protein y (psrp-1); PDBTitle: crystal structure of ribosome-associated protein y (psrp-1)2 from clostridium acetobutylicum. northeast structural3 genomics consortium target id car123a
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.........90......
Predicted Secondary structure 



















Query SS confidence 

















































Query Sequence  ELQGQPHNMVRHPDMPKAAFADMWFTLKKGEPWSGIVKNRRKNGDHYWVR
Query Conservation 



     
  
             
  
     
     


    
 
Alig confidence 















.................
















Template Conservation 

  
 
 

 
  
 ................. 






 

 




Template Sequence  ELLGHNFFVFQNGDSN. . . . . . . . . . . . . . . . . EVNVVYKRKDGNYGLIE
Template Known Secondary structure  T
STTTT.................
TTS

Template Predicted Secondary structure 







.................





Template SS confidence 

















































   23......30........ .40.........50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions