Return to main results Retrieve Phyre Job Id

Job DescriptionP50466
Confidence41.97%DateThu Jan 5 12:04:47 GMT 2012
Rank96Aligned Residues33
% Identity15%Templatec3k2tA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:lmo2511 protein; PDBTitle: crystal structure of lmo2511 protein from listeria2 monocytogenes, northeast structural genomics consortium3 target lkr84a
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.........90......
Predicted Secondary structure 



















Query SS confidence 

















































Query Sequence  ELQGQPHNMVRHPDMPKAAFADMWFTLKKGEPWSGIVKNRRKNGDHYWVR
Query Conservation 



     
  
             
  
     
     


    
 
Alig confidence 















.................
















Template Conservation 

    
 

 
  
 ................. 






 

 




Template Sequence  NLLGHSFYVYTDAETN. . . . . . . . . . . . . . . . . GTNIVYSRKDGKYGLIE
Template Known Secondary structure  T
SBSSS
.................

TTS

Template Predicted Secondary structure 






.................





Template SS confidence 

















































   23......30........ .40.........50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions