Return to main results Retrieve Phyre Job Id

Job DescriptionP32169
Confidence13.41%DateThu Jan 5 11:49:47 GMT 2012
Rank38Aligned Residues24
% Identity25%Templated1j5ua_
SCOP infoMTH1598-like MTH1598-like MTH1598-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   213......220.........230.........240..
Predicted Secondary structure 


Query SS confidence 





























Query Sequence  GVFGSGPTLDETFGLIDTAEKSAQVLVKVY
Query Conservation 


  
 

 

    
 

  
 
   
 
Alig confidence 












......










Template Conservation       
 





......
 
  

    
Template Sequence  AYEISGNSYEELL. . . . . . EEARNILLEEE
Template Known Secondary structure  SS......
Template Predicted Secondary structure 

......
Template SS confidence 





























   18.20.........30 .........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions