Return to main results Retrieve Phyre Job Id

Job DescriptionP77717
Confidence7.74%DateThu Jan 5 12:32:02 GMT 2012
Rank35Aligned Residues31
% Identity32%Templatec1cidA_
PDB info PDB header:t-cell surface glycoproteinChain: A: PDB Molecule:t cell surface glycoprotein cd4; PDBTitle: crystal structure of domains 3 & 4 of rat cd4 and their2 relationship to the nh2-terminal domains
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   86...90.........100.........110.........120.........130
Predicted Secondary structure 















Query SS confidence 












































Query Sequence  AQKAVRTEGKQSPFSFVLSFNPADVQPNARILLSAAITVNDKLVF
Query Conservation 
 
     
 


  
 
 

   
 
  

 
 


   




Alig confidence 
























..............





Template Conservation      
  

 
  


 


  
  ..............



 
Template Sequence  SITAYKSEGESAEFSFPLNLGEESL. . . . . . . . . . . . . . QGELRW
Template Known Secondary structure 

TTS





SS

..............
Template Predicted Secondary structure 







..............
Template SS confidence 












































   2.......10.........20...... ...30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions